SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226362086|ref|YP_002779864.1| from Rhodococcus opacus B4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226362086|ref|YP_002779864.1|
Domain Number 1 Region: 213-321
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.9e-27
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0061
Further Details:      
 
Domain Number 2 Region: 15-108
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 6.41e-27
Family Ferredoxin reductase FAD-binding domain-like 0.00067
Further Details:      
 
Domain Number 3 Region: 106-229
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.31e-25
Family Aromatic dioxygenase reductase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226362086|ref|YP_002779864.1|
Sequence length 322
Comment oxidoreductase [Rhodococcus opacus B4]
Sequence
MSQNPVSSGTPADAALRVDAKVVVAEGVVALTLRHPTGRRLPDWAPGAHIDLVLPNGLTR
QYSLCGDRWDAHSYRVGVLREPSGRGGSAYVHDELAVGDLVGVGGPRNNFPLVPSQKYLF
VAGGIGITPLLPMIRQAELIGADWRLVYGGRTRTSMAFREELAAYGDRVVFLPRDERGLP
DLPAYLAEATDAKVYVCGPGALLAAVEKCCADWAVGRLRTERFVPKDRGAPLRNEPFEVE
LARSGLAVTVNPGATVLDAVQAAGVNVLSSCRGGTCGTCETTVLAGAPDHRDSVLDDDER
SAGDCMLICVSRSCSDRLVLDL
Download sequence
Identical sequences C1B4Z3
gi|226362086|ref|YP_002779864.1| 632772.ROP_26720 WP_012689875.1.34288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]