SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226362421|ref|YP_002780199.1| from Rhodococcus opacus B4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226362421|ref|YP_002780199.1|
Domain Number 1 Region: 91-212
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.27e-27
Family Aromatic dioxygenase reductase-like 0.043
Further Details:      
 
Domain Number 2 Region: 202-301
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.95e-22
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0054
Further Details:      
 
Domain Number 3 Region: 3-93
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.23e-20
Family Ferredoxin reductase FAD-binding domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226362421|ref|YP_002780199.1|
Sequence length 310
Comment oxidoreductase [Rhodococcus opacus B4]
Sequence
MWMRVAQKRAETADVVSLVLEREDGSEVPCWTPGAHVDICVADFVRQYSLCSVPAQRQAW
RLGVLGQAAGRGGSVAVSGLNEGDVVEVSEPRNHFEFLESRRYLFVAGGIGITPILPMVQ
AAHDAGAEWRLVYGGRSRATMAFTEELAAYGDRVTLISEDEEGLIDLKATLARSDDETRI
YACGPEPMLDALEVAMDRGVPGVLHLERFSPKTLADVPEDEPFEVEFVTSGISRTVPVGR
SILEIAVEEGLDVFSSCEEGTCGTCVTSILSGCADHRDSLLTKAEQDRHDVMCICVSRAQ
PNSGPLCLDL
Download sequence
Identical sequences C1B6F1
WP_012690210.1.34288 632772.ROP_30070 gi|226362421|ref|YP_002780199.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]