SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226363502|ref|YP_002781284.1| from Rhodococcus opacus B4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226363502|ref|YP_002781284.1|
Domain Number 1 Region: 101-224
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.49e-28
Family Aromatic dioxygenase reductase-like 0.0055
Further Details:      
 
Domain Number 2 Region: 6-103
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1e-25
Family Ferredoxin reductase FAD-binding domain-like 0.001
Further Details:      
 
Domain Number 3 Region: 210-314
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.7e-24
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226363502|ref|YP_002781284.1|
Sequence length 319
Comment vanillate demethylase reductase subunit [Rhodococcus opacus B4]
Sequence
MPTAPEPVLELELTARTTGADGVVVLEFRDPSGAALPGWTPGAHIDLLLTPELTRQYSLC
GDPADTGTWRVAVLREAMGRGGSQFVHDKLSEGDTVTVRGPRNHFALEPSPRYVFVAGGI
GITPILTMAHAAENAGADWTLVYGGRSRSSMAFADTLAERFDDRVVIHPQDEHGLIDLPG
LLGNVRENTLVYCCGPAPLLDAVTAHCDDWPSGTLHLERFAAKDLEEPVRAEGFEVELTL
SGKTVTVAPEQSILQAVTAAGVQVLSSCEEGTCGTCETPVLGGTVDHRDSLLTADEQAAN
DTMMICVSRASCPRLTLEL
Download sequence
Identical sequences C1B9I6
gi|226363502|ref|YP_002781284.1| 632772.ROP_40920 WP_012691275.1.34288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]