SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257067267|ref|YP_003153522.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067267|ref|YP_003153522.1|
Domain Number 1 Region: 30-275
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 1.83e-67
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000314
Further Details:      
 
Domain Number 2 Region: 260-410
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 2.26e-46
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.0000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257067267|ref|YP_003153522.1|
Sequence length 418
Comment butyryl-CoA dehydrogenase [Brachybacterium faecium DSM 4810]
Sequence
MNTTSPHQEPSVTRTATSPARSTPPPGTELLSEEHQRLAARVRDFADEVVAPASYTYDTE
RRLPMEILAEMGAMGLFGLPLPRTYDGQGRDYLSLCVAVEQLARVDQSIAVTLEAGLGLG
AMPILTFGTAAQKERHLPALARGEQLAAFGLTEAEAGSDAGGTRTTARLEDGQWVIDGTK
QFITNSGTPITSLVTITAVTGQRQGRDGRSSPELSSIIVPTDTPGFTVLPGYDKVGWHTS
DTHPLLLEGVRVPEENLLGERGRGFANFLAILDQGRVALAALCVGAAQGCLEQAVRYARE
RVVFGRALGENQHIAFTLARMQARVASARALMHEAAHRLDAGMPFSREASLAKLVGSEAA
VANARDACQIWGGNGFLNENVVARHYRDSRVLEVGEGSTEVQLAIIAKHLGFPNALTG
Download sequence
Identical sequences C7MF32
gi|257067267|ref|YP_003153522.1| 446465.Bfae_00480 YP_003153522.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]