SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257067268|ref|YP_003153523.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067268|ref|YP_003153523.1|
Domain Number 1 Region: 77-222
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 9.15e-16
Family GntR ligand-binding domain-like 0.015
Further Details:      
 
Domain Number 2 Region: 7-74
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000121
Family GntR-like transcriptional regulators 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257067268|ref|YP_003153523.1|
Sequence length 230
Comment transcriptional regulator [Brachybacterium faecium DSM 4810]
Sequence
MAVRRQVLRAEVEELILQRLLESRWAPGSRLSIDGLARDLEVSPTPVREAMVSLERSGLV
EYVALRGYVVAPPLDAEHMSELLDARKVVESAALGRAFEDYDSLLADLEEAHRAHAEVLA
RIDETGPEDYALLNEHFRADWAFHQVFFAHAHNRYLRTMVENLSTYTHRMRQTWSGGPAT
FDGRTAHEEHGAILEMVRRHHHDGALGALSAHLDGVLARSLAAVEEGAAR
Download sequence
Identical sequences A0A1X6XZC1 C7MF33
YP_003153523.1.138 446465.Bfae_00490 gi|257067268|ref|YP_003153523.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]