SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257067316|ref|YP_003153571.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067316|ref|YP_003153571.1|
Domain Number 1 Region: 8-150
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 9.92e-36
Family Deoxycytidylate deaminase-like 0.0000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257067316|ref|YP_003153571.1|
Sequence length 175
Comment cytosine/adenosine deaminase [Brachybacterium faecium DSM 4810]
Sequence
MTWTPTAEDDRRFLSLAIEQARKSWDEGGVPIGAVLVHDGKVLAAGHNQRVQKDSAILHG
ETDTIEKAGRLRASVYRESVLYTTLSPCIMCAGTALLYEIPRIVIGENRAFEMSEALLRE
RGVAVDVLDDPECIELMERMIAERPEIWSEDIGVETAELGARTDAPGAADEGQGR
Download sequence
Identical sequences A0A1X6WVA0 C7MF81
gi|257067316|ref|YP_003153571.1| 446465.Bfae_00990 YP_003153571.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]