SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257067330|ref|YP_003153585.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067330|ref|YP_003153585.1|
Domain Number 1 Region: 3-328
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 1.83e-60
Family Aldo-keto reductases (NADP) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257067330|ref|YP_003153585.1|
Sequence length 345
Comment putative oxidoreductase, aryl-alcohol dehydrogenase like protein [Brachybacterium faecium DSM 4810]
Sequence
MSMQHRTPARLGRPLSVVGQGCWQIGADWGEVTDESATAVLDAALEAGVTFFDTADVYGD
GRSERLLGALRTRLSTDGAAPVGGASALPFVATKASRRADPFAPETFTEENLRAWVERSR
ENLGMDTLDLVQLHCPPPAIYRDDRVFDVLDALVQEQRIAAWGVSVETCQEALISLEREH
LASIQIIVNPFRLKPLEQVLPAAAEKGVALIARVPLASGLLTGKFSATSRFAEDDHRRFN
RHGEAFDQGETFSGVDFETGLAAVARLEQALEGAMPLPEASLRWILAQRGVTAVIPGASS
GEQARANAAAGSAPTAAQQEVLQRFDAAVHETYDALLRESIHPRW
Download sequence
Identical sequences C7MF95
gi|257067330|ref|YP_003153585.1| 446465.Bfae_01130 YP_003153585.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]