SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257067396|ref|YP_003153651.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067396|ref|YP_003153651.1|
Domain Number 1 Region: 72-298
Classification Level Classification E-value
Superfamily MetI-like 3.66e-61
Family MetI-like 0.0000583
Further Details:      
 
Weak hits

Sequence:  gi|257067396|ref|YP_003153651.1|
Domain Number - Region: 23-48
Classification Level Classification E-value
Superfamily Bacterial photosystem II reaction centre, L and M subunits 0.0089
Family Bacterial photosystem II reaction centre, L and M subunits 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257067396|ref|YP_003153651.1|
Sequence length 312
Comment permease of ABC-type sugar transporter [Brachybacterium faecium DSM 4810]
Sequence
MTIDAAHRVDPGAKRRRGGLERTQWVALAFATPLLVYLVGFYVYPLMRSIDLSVHDYTVR
AFVQGDAEFVGLSNYLDVISSPLFGKAIVNTVVFVGGSLIFQYAIGLALAVFFRSSFRLS
GILRALFLVPWLLPLIVSGSVWAWMMNSESGVVNFLLGIVGIDPVNWLTSPDTAMLAVVI
ANIWLGIPFNLVILYSGLQNIPEDLYEAASLDGAGSGKQFWSITFPLLRPVTAITLLLGL
VYTLKVVDIIWVMTTGGPADASTTLAIWSYREAFGTGQPDMSPAAAVGNILIVIALLCGL
LYTYVQRRQEES
Download sequence
Identical sequences C7MFU3
YP_003153651.1.138 446465.Bfae_01820 gi|257067396|ref|YP_003153651.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]