SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257067441|ref|YP_003153696.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067441|ref|YP_003153696.1|
Domain Number 1 Region: 654-847
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.75e-24
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.018
Further Details:      
 
Weak hits

Sequence:  gi|257067441|ref|YP_003153696.1|
Domain Number - Region: 35-88,168-271
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00011
Family FAD/NAD-linked reductases, N-terminal and central domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257067441|ref|YP_003153696.1|
Sequence length 867
Comment putative dinucleotide-binding enzyme [Brachybacterium faecium DSM 4810]
Sequence
MTSRISPARTRLVLVGGGPRAIGVLERLGASAAQPAAAERLARTPLHVDIVDPHMPGAGR
IWRAHESPLLLMNSRAADVSIHPDETVDCEGPVRTGPSLAEWAEGIRRGTIAAPTAGTER
LAEIEALQPTDFASRRVQALYLEWFFGQVLAALPSTVSVAVHRTTATAVRSADGVRPAAA
VGPADGTAWTVELEDRAPLHADLLLLAAGHTDSRPSAERHQLAVFARRHGGTYLAPSQAS
DAQLDLLAPGQDVIVRGMGLAFIDLMALLSEGRGGVFEPAPLPGDPDRLSYRPSGREPRL
WVGSRRGVPYHSKVRDEGAPAGPGDLVHVTAENLRAREDAQGRLDFRADVVPLIAAEIRR
WVPGAPSAAPGEDPLAWLDDPLSWLEGEAHPQVTRDAVVRHIETDLHARTRGDASSARAL
FQLLLRLHGVLVDQLPATRLRPGAQGDYPRWWHSLFSFVDSGPPPHRLHQLLALERAGVV
RFLGPRVQVRAEESTGRFTARGAAGAHVTADALLDAFLPEASLVESTNPLLRDLVTGGSA
AVGRESAATPGSLEVDARHSVIGPDGTARPRLWAVGPWTSELPIGAFARPHTNAPCHRRN
DALGRELLEAALRHGEAAASQGERAPSQGAGALRHGETVLRHGETVRRTGQPARLGVMGP
GKIGRALARTALRRGLEVRVSGRAPAAALAAALPGAHPVEVAELASTCEVVAITVPLHVA
LTLDPATLHGAVVIDATNPWGEADAAAVAAARRTLGDAEGLLSTSELLAAHLPGARVVKT
LNHIGYHDVEDQGREGGDPHRRAIALAADDPQAADAVAALLHRIGFEPVRVGTLAAGRQL
EPGAGLFAGWSTSEELSERRRELVRVA
Download sequence
Identical sequences C7MFY8
YP_003153696.1.138 gi|257067441|ref|YP_003153696.1| 446465.Bfae_02280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]