SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257067477|ref|YP_003153732.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067477|ref|YP_003153732.1|
Domain Number 1 Region: 4-74
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000718
Family Tetracyclin repressor-like, N-terminal domain 0.0056
Further Details:      
 
Weak hits

Sequence:  gi|257067477|ref|YP_003153732.1|
Domain Number - Region: 102-177
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00274
Family Tetracyclin repressor-like, C-terminal domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257067477|ref|YP_003153732.1|
Sequence length 179
Comment transcriptional regulator, tetR family [Brachybacterium faecium DSM 4810]
Sequence
MSARDALLDAYQSLLQEAGERATTLTAVAARAGVSKGGLLYHFASKEALAAGLIARLDAL
VEEDLAQMRAAADGPSRYYVRTSVWTGGALDNALIAVAQLAQESHVEAQRAMRRAREQWL
ELIGTEVDEEATAHAILLLGDGLYFDAALGGGTDPAEPGRFSPEQLMPIVDRLLRAARE
Download sequence
Identical sequences A0A1X6X970 C7MG24
YP_003153732.1.138 446465.Bfae_02650 gi|257067477|ref|YP_003153732.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]