SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257067585|ref|YP_003153840.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067585|ref|YP_003153840.1|
Domain Number 1 Region: 7-261,353-405
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.55e-60
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000434
Further Details:      
 
Domain Number 2 Region: 234-350
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2.24e-36
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000452
Further Details:      
 
Domain Number 3 Region: 435-515
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 3.27e-16
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257067585|ref|YP_003153840.1|
Sequence length 534
Comment L-aspartate oxidase [Brachybacterium faecium DSM 4810]
Sequence
MAGQPAPLRTEVLVVGSGIAGLTAALTAAERSDVLLVTKGELAEGATCRAQGGIAGAVGP
GDSPAAHARDTLAAGAGLGDAEAVQVLCAQGPAAIAELLARGVVFDRAEDGSCALGLEGA
HDRPRILHAGGDATGRAIEHALIRAARARAAEGARGGLTLLEDTALVDLQVAQGQVVGAE
LLAADGSRVRVRARSTVLATGGAGQLFAHTTNPAVATGDGLAAAWRAGAALEDLEFFQFH
PTALAVKGPHASFLVSEAVRGEGALLRDAQGRRFLPALDPRGELAPRDVVARAIAHVMAA
QGGRPVLLDATAIGAERLRRRFPTIDAAVRAAGIDWGREPVPVTPAAHYWMGGIRTDLDG
RTTLPGLHAAGECARTGVHGANRLASNSLLEGAVFGARAGAAAATSTPADHGSPAAGPTG
AGEELPPRTATGRAWSRTELQELLWSHAGLLRSGTALEEAAAELATWRAPDPAAHITARE
LEDRNLLDLARLLLAHALARPGSVGAHHRLDEPGTTAAPHPVPSLDLTPEAPAC
Download sequence
Identical sequences C7MGQ9
446465.Bfae_03760 gi|257067585|ref|YP_003153840.1| YP_003153840.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]