SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257067621|ref|YP_003153876.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067621|ref|YP_003153876.1|
Domain Number 1 Region: 215-456
Classification Level Classification E-value
Superfamily MetI-like 2.09e-47
Family MetI-like 0.00000641
Further Details:      
 
Domain Number 2 Region: 122-216
Classification Level Classification E-value
Superfamily MalF N-terminal region-like 0.000000811
Family MalF N-terminal region-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257067621|ref|YP_003153876.1|
Sequence length 470
Comment permease of ABC-type sugar transporter [Brachybacterium faecium DSM 4810]
Sequence
MTQTLVKREAPPSVPERPAPQQSSAWVAGLASALLWGSGQAMNRQYAKGLIFLTLMVATV
ATELVTGYYGNLTSYSFRRNGGFFLRGLWGLITLGTEPRSTGLTGLTGGDHSIVLMVNGL
IALLTLLVIAALYAWNVIDAVRTRRILIRTGTAPTSREYFTTLWQSSYAYIVLSPLLALL
LFVSALPIIFGILIAFTNYNRDNLPPLSLVDWVGLSNFTAIFSIKAWSGTFLGVLTWTVV
WAIVATVTTYLFGFIQAVILNSSRVRYPRFWRSIYILPWAVPAMISALVFRSMFNGQFGP
INQILLDWGLIDQRIYWFTDPSNALLARVMALLVNLWLGFPYFMALIGGALTNIDKNYYE
AAVLDGASSSQILRRITFPIIYRATAPLAVLAFVANFNNFGVIYFLTEGGPANSNYQFAG
STDLLITWLFTLTVDNRLYNIGAVMSIVIFVLVGTFSLWNLKRSRAFDEL
Download sequence
Identical sequences C7MGU5
gi|257067621|ref|YP_003153876.1| 446465.Bfae_04130 YP_003153876.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]