SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257067627|ref|YP_003153882.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067627|ref|YP_003153882.1|
Domain Number 1 Region: 65-293
Classification Level Classification E-value
Superfamily MetI-like 1.01e-46
Family MetI-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257067627|ref|YP_003153882.1|
Sequence length 313
Comment ABC-type polysaccharide transporter permease [Brachybacterium faecium DSM 4810]
Sequence
MRSGPRRPKKSLSARLRRDWQMLVLMIPGALALLFFFYIPILGNVIAFQDYQPYLEITEA
PFVGFSKFTELFQDDRFVLALRNTLVYAAFQLVLFFPLPILLALIVDSMMSQRLRKAFQS
IVYLPHFLSWVLVIALFQQMLGGAGLINQAMVSSGLDPIPFMTNSDSFALLIVAEIAWKD
AGWGMIIFLAALASIDQSLYESAASDGAGRVRRTWHITLPGMRPVIVLLLILNLGSILTV
GFEQFILQRDAVGADTAEVLDTYSYYTGVIGGDWSVGAAAGLAKGVVGTILIILANKVAH
LLGEDGIYRGRPQ
Download sequence
Identical sequences C7MGV1
YP_003153882.1.138 gi|257067627|ref|YP_003153882.1| 446465.Bfae_04190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]