SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257067651|ref|YP_003153906.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067651|ref|YP_003153906.1|
Domain Number 1 Region: 20-355,496-530
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.96e-59
Family FAD-linked reductases, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257067651|ref|YP_003153906.1|
Sequence length 548
Comment phytoene desaturase [Brachybacterium faecium DSM 4810]
Sequence
MSPARGPRRSRDVPAGSDPVVVIGGGISGLATAALLARDGHEVDLVEAREELGGRAGTWE
RDGFRFDTGPSWYLMPEVFDHFFRLLGTSADEQLDLRPLDPGYRVRFEGCEEAWDVSASA
ARNADLFEQVERGAGLRLARYLDSAARTYDVALERFLYTSYTTPRAFLSPTVLTQAPRLL
ALLAEPLDRFVARRFRDPRLRQLLGYPAVFLGSSPDRTPSMYHLMSALDLTGGVRYPQGG
FTRLIEAIVRLAEHEGVRLHTGTRATALLTAPGESRRPNGRGPRRGAAVRGVEVQAADGT
LRTLPARTVVATADLHHVETTLLPQELQTYPASWWRRRTPGPGAVLVLLGVRGRLPQLAH
HTLFFTRDWAENFGALREGRVPSPASSYVCRPSATDPSVAPADHENLFVLVPVPADPGLG
RGGEDGAGAAAVERIADEAIARIAAEAGIPDLAERIVVRRTIGPGEFATDLGAWQGSMLG
PAHTLRQSAFFRAGNASRRVDGLLYAGSSTLPGIGLPMCLISAELVAKRMRGDRSSAPLP
EPSPAVPA
Download sequence
Identical sequences C7MHA7
gi|257067651|ref|YP_003153906.1| YP_003153906.1.138 446465.Bfae_04430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]