SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257067676|ref|YP_003153931.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257067676|ref|YP_003153931.1|
Domain Number - Region: 18-80
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0286
Family Anti-sigma factor antagonist SpoIIaa 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257067676|ref|YP_003153931.1|
Sequence length 126
Comment hypothetical protein Bfae_04710 [Brachybacterium faecium DSM 4810]
Sequence
MTHKISLLIRADIDLDAIELVVTGCLTEQSVTALLEQIARARMLDPASPIRVDLTGAQHI
EPRAVDVLHEHAARDPLTHRRALRVDLPEELPACPLESPVLPATSPRRVLPAPARPAREH
RAAAGG
Download sequence
Identical sequences C7MHD2
446465.Bfae_04710 YP_003153931.1.138 gi|257067676|ref|YP_003153931.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]