SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257067679|ref|YP_003153934.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067679|ref|YP_003153934.1|
Domain Number 1 Region: 5-65
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase, C-terminal domain 0.00000000000000301
Family Methylated DNA-protein cysteine methyltransferase, C-terminal domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257067679|ref|YP_003153934.1|
Sequence length 97
Comment putative methylated DNA-protein cysteine methyltransferase [Brachybacterium faecium DSM 4810]
Sequence
MREPEEAVRAIAARIPPGSVMTYGDIAVEAGLPPRQVGRIVARISEDIPWWRVIRADGTP
ATCHDGTAPALLAREHVPFVGGRVDLRALRGSVPGGA
Download sequence
Identical sequences A0A1X6XQT0 C7MHD5
YP_003153934.1.138 gi|257067679|ref|YP_003153934.1| 446465.Bfae_04740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]