SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257067689|ref|YP_003153944.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067689|ref|YP_003153944.1|
Domain Number 1 Region: 308-568
Classification Level Classification E-value
Superfamily MetI-like 3.36e-53
Family MetI-like 0.0000929
Further Details:      
 
Domain Number 2 Region: 26-291
Classification Level Classification E-value
Superfamily MetI-like 1.59e-47
Family MetI-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257067689|ref|YP_003153944.1|
Sequence length 587
Comment ABC-type Fe3+ transporter permease [Brachybacterium faecium DSM 4810]
Sequence
MTLTARPAAAATPTMGRSRLQLTASDRFVYVLAIPLVLVLLIYIVFPMIATVFTSVEDGG
AAYSDFVSGNSRRALALSVGISLASVFTAGVVGTGLAVLLTRFSFPGRSVLKVFALLPLA
LPPLIGALSFYYLYGTSGIIPRLLHEVTGIPAATMSFDGVAGVMLVHTLTMYPYFYLSVT
AGLSGSDASLEEAAMNLGASRSAMWRTVLLPMLTPALVSGALLTFMVSMASFTAPQFYNV
NTLTMRIVAAKTSGAYDLAAAQSTVLSVVSILFLLLMRWYQNRRLTRSMSKGTPQAVKTV
QGIIPQAGAALGSAVIVLILAAPVAAIVLLAFTVNGTWTTQIIPPDYTLQNFIDIFTEPR
SLRPLLVSSQMSAVAMAASIVVGVLTAWVIARWKGKGAGILDLMIMLPWALPGTVVGINI
VTAFASPTPFNLGQVFIGSLWILPLAYFIRFVPLVFRNAAASLAQIDPSVEEAAQNLGAG
PFRTLRTITLPLMARGVIAGALLAFVQGFGEYVASVVIYPARFVPLSVEIYNRQYANDLG
SAFAYGSLQVLAILIVLIISEVLEKPGRFTRRRRTGDSAATAAATAA
Download sequence
Identical sequences C7MHE5
446465.Bfae_04850 gi|257067689|ref|YP_003153944.1| YP_003153944.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]