SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257067696|ref|YP_003153951.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067696|ref|YP_003153951.1|
Domain Number 1 Region: 58-284
Classification Level Classification E-value
Superfamily MetI-like 2.22e-48
Family MetI-like 0.000064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257067696|ref|YP_003153951.1|
Sequence length 292
Comment permease of ABC-type sugar transporter [Brachybacterium faecium DSM 4810]
Sequence
MITRVFGRQPFGLALAAPYVVFLAVVMAYPLASAVWISFYDYVFAAPGMSIDHEFVGLAN
YRAALSDPRVQQSFVNIAVFLAINVPLTVGLSMVLASALNAITRWTAAFRVAFYVPYVTA
SVSLIGVWMLLFSEGGIVNSALGPLAPSPSWLVNESLAMPSIALFVTWKQLGFYILLYLA
ALQAVPQELYESASTDGAGVLQRFKHITIPSLRPTTLIVLILSIIIGANLFTEPYLLTNG
GGPDGASSSPVLMIYQKGIQQGNPDVASAIGVLLVIGVGLLSLISARLTKES
Download sequence
Identical sequences C7MHF2
gi|257067696|ref|YP_003153951.1| 446465.Bfae_04920 YP_003153951.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]