SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257067758|ref|YP_003154013.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067758|ref|YP_003154013.1|
Domain Number 1 Region: 85-273
Classification Level Classification E-value
Superfamily MetI-like 2.22e-25
Family MetI-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257067758|ref|YP_003154013.1|
Sequence length 288
Comment ABC-type dipeptide/oligopeptide/nickel transporter permease [Brachybacterium faecium DSM 4810]
Sequence
MSLQTLTRDQAPAPTPARSRARRLPALRPTVVLSALVLLLAITWALAPGLFTSYGATASV
GPSLQAPSAEHWFGTDATGRDMFSRVVHGASHSITAALVAVAVGLVVGTTIGVVAGSVGG
FVEDVLMRVVDVLLAIPGLLLSLSVVILLGFGTTNAAIAVGVTSIATFARLSRSRVLEVR
RSEYVEAAFGSGGTLPAILWRHILPNSAAPVIALAALQLGSAILQISTLGFLGYGAPPPT
PEWGLLIAEGRDYVATAWWLTLLPGLVVAAVVLSTNRLSDAIGKAQRP
Download sequence
Identical sequences A0A1X6X9Q1 C7MHL4
446465.Bfae_05570 YP_003154013.1.138 gi|257067758|ref|YP_003154013.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]