SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257067811|ref|YP_003154066.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067811|ref|YP_003154066.1|
Domain Number 1 Region: 11-372
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.08e-95
Family FMN-linked oxidoreductases 0.0000000685
Further Details:      
 
Domain Number 2 Region: 344-529
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.22e-33
Family N-terminal domain of adrenodoxin reductase-like 0.0000644
Further Details:      
 
Domain Number 3 Region: 480-639
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000296
Family C-terminal domain of adrenodoxin reductase-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257067811|ref|YP_003154066.1|
Sequence length 688
Comment 2,4-dienoyl-CoA reductase [Brachybacterium faecium DSM 4810]
Sequence
MPAPLPHPTTPSAHPRLLSPLDLGPFEVRNRIVMGSMHVGLEDRPGDAKKLAAYLGERAR
GGAGLIVTGGYSPDRTGRLTPGGAQADARTLRGHRLVTREVHEADGRVLLQLLHAGRYAF
HPLSASSRSGKSPISPFRARRLTRRGVGRTVEHFAEAAQRAVAAGYDGVEIMGSEGYLLN
QFLAPATNRRRDRWGRGAEGRRALPLAVAAAVREAIGEKALLSYRISLLDLVPGGQTWEE
TGALARGLVERGVDVLSSGIGWHEARVPTIVTSVPRAAFAENTAALRELVDVPVIASNRI
HDPAVAEEVLAAGQADLVSMARPLLADPHLPRKLAEGRAAQVVACISCNQACLDKVFDGK
RASCLVNPRAGHETELVLTPVAERRLRKVAVVGAGPAGLEAALAAAERGHIVTLYEATAE
IGGQLRLAARIPGKEDYAQALQSWRMRLAAAGVGIRLETRPTGRDLAGFHDVIVATGVAP
RVIDLPVEPGGPQVISYADLLEGRAEAGERVAIIGAGGIGVDVAEFLSAPRPSPSLDVTV
WKRHWGVVEADEEHRGGVATRPVEEAPREVHLLQRKETRIGAGLGRTTGWVHRAELRHAG
VIQHRGVAYRHVDARGLHILEDGEETVLEVDTVVVCAGQVSVDDLAAEVTAARKGRAPRV
HVVGGADVAAELDAERAIRQAVEVVAGL
Download sequence
Identical sequences C7MI50
446465.Bfae_06110 gi|257067811|ref|YP_003154066.1| YP_003154066.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]