SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257067828|ref|YP_003154083.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067828|ref|YP_003154083.1|
Domain Number 1 Region: 62-291
Classification Level Classification E-value
Superfamily MetI-like 1.44e-53
Family MetI-like 0.0000792
Further Details:      
 
Weak hits

Sequence:  gi|257067828|ref|YP_003154083.1|
Domain Number - Region: 17-62
Classification Level Classification E-value
Superfamily MalF N-terminal region-like 0.0017
Family MalF N-terminal region-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257067828|ref|YP_003154083.1|
Sequence length 303
Comment permease of ABC-type sugar transporter [Brachybacterium faecium DSM 4810]
Sequence
MSHDTAPAAPRRARSRDGVWPLVFLAPLMIGVAVFYFWPILATFLNSFSSFGPFGGRSFA
GLDNYRALLTDSFIPRAVLNTAVYTAIVLLGIPIAVAVASLMNQKGLRFSRFYQVLFFLP
AVSMPVAVALVWRMIFNKEFGIVNWALSLVGIDGPYWTTAPWWALLAVSIVGLWSSLPLA
IIILSAGLQAIPAELYEAAQLDGAGTMRQFIAVTVPLLTPSIFFLTIITAINGFQLFDLL
FAMMGDANPAMADTQSLVYLFYSEAFRQNDQGYASVIALLILLIIGVFTLLQFRMQKRWV
HYE
Download sequence
Identical sequences A0A1X6X1D6 C7MI67
446465.Bfae_06280 YP_003154083.1.138 gi|257067828|ref|YP_003154083.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]