SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257067880|ref|YP_003154135.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067880|ref|YP_003154135.1|
Domain Number 1 Region: 118-412
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.55e-82
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000622
Further Details:      
 
Domain Number 2 Region: 1-106
Classification Level Classification E-value
Superfamily tRNA-binding arm 1.52e-22
Family Seryl-tRNA synthetase (SerRS) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257067880|ref|YP_003154135.1|
Sequence length 423
Comment seryl-tRNA synthetase [Brachybacterium faecium DSM 4810]
Sequence
MIDLRHLRENPEAVRDAQRARRRDPATVDAVLEADVRWRETTAAFESARAEQKSFGKKVA
QAKGEEKQALLAEVKQLAADVKRLEAEAGEALTIRDAALREIPNLAEGAPEGLEDDFTVR
EHVGEVPRFDHPVKDHLEIAEGLRAIDMARGAKVSGARFYFLRGIGAQLELAILNSAIDQ
ATRAGFTPMITPTLVLPEAMEGTGFLGEHADEVYHLDKDDDLYLVGTSEVALAGYHKDEI
IDLSDGPLRYAGWSACYRREAGSYGKDTRGIIRVHQFHKVEMFSYCRIEDSYAEHERLLD
WEREMMARIDVPYRIIDTAAGDLGTSAARKFDCEAWMPSQETYRELTSTSNTTQFQARRL
NIRERTEDGLRPVATLNGTLGTTRFLAAILENHQQGDGSVVVPEGLRPYLGGREVFEPVG
GAA
Download sequence
Identical sequences A0A1X6XRP4 C7MIB9
YP_003154135.1.138 gi|257067880|ref|YP_003154135.1| 446465.Bfae_06830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]