SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257067916|ref|YP_003154171.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067916|ref|YP_003154171.1|
Domain Number 1 Region: 90-234
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 4.18e-19
Family GntR ligand-binding domain-like 0.006
Further Details:      
 
Domain Number 2 Region: 12-108
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.69e-18
Family GntR-like transcriptional regulators 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257067916|ref|YP_003154171.1|
Sequence length 266
Comment transcriptional regulator [Brachybacterium faecium DSM 4810]
Sequence
MRSRQEAVQLPMMQPIRRPSIIDQAELELRNAIYFGDLRPGDTIPEVQVSKQMGISRSSL
REACQRLVRDGLLTQIPGRGLFVTRMDAETMSDFIDYRLGIEMQAASIVADRVTTLRAAG
DDAGAEALLAPLRDTLERTRRALDAEEVIEAGNADLELHQQIAEIARNRFLISSMSTIVI
LTRMGSFSDPRGFGVRADISTAHEKLLDALAAGDASRARAVLRDTLQELASRLRSGETEQ
EVVRDPDLLESDGPEWTTLDGGGTAP
Download sequence
Identical sequences A0A1X6XA46 C7M9N7
446465.Bfae_07250 gi|257067916|ref|YP_003154171.1| YP_003154171.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]