SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257067980|ref|YP_003154235.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257067980|ref|YP_003154235.1|
Domain Number 1 Region: 318-492
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.95e-36
Family Histidine kinase 0.0017
Further Details:      
 
Domain Number 2 Region: 253-327
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.24e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0033
Further Details:      
 
Domain Number 3 Region: 196-243
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000798
Family HAMP domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257067980|ref|YP_003154235.1|
Sequence length 529
Comment signal transduction histidine kinase [Brachybacterium faecium DSM 4810]
Sequence
MALPSLRTERPVSLWTRIVALISLLLVLGTVVTGSLSLFLLNRTLIQSVDNNLQSGMGEM
LALAQHELAGDDAIQNSTYTPVEYAIEIRDAQGRSIEQAVVHYGPGSVSLPFPDLTDEQI
LHRGGRPFTVLDSAENRWRVVAMLNSGPEGGSVYVALPLTGVDRTMHEMALIIVLVGTLV
VLVGMGLGGYVTHRSLEPLRDVEATASQIAGGDLSRRVPVTRTSLEVHDLALSLNEMLVR
IEQSFAAQSASEERATLSEAKMRRFVGDASHELRTPLAAIRGFGELYRMGALPTDEDVSS
AMRRIEDEARRMGSLVENLLRLARLDEKPELDLAPVDFTDALFDAAQDLRALDPGRQVMV
TSLSGTPLSVQPHVSIGVLGDEASLRQVILNLVGNANRHTPKGSPVEIAVGYTPQGTARI
EVRDHGEGIDDDQREKVFERFYRTDASRARSATQGGGAGLGLSIAASIVQQHRGSIGVTE
TEGGGATFWVELQGTEIAPEQQVEPDQRRALGAEPDDAAPPTPEDPAQG
Download sequence
Identical sequences A0A1X6Y073 C7M9V1
YP_003154235.1.138 446465.Bfae_07900 gi|257067980|ref|YP_003154235.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]