SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068024|ref|YP_003154279.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068024|ref|YP_003154279.1|
Domain Number 1 Region: 357-597
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.66e-62
Family ABC transporter ATPase domain-like 0.0000746
Further Details:      
 
Domain Number 2 Region: 81-273
Classification Level Classification E-value
Superfamily MetI-like 6.87e-18
Family MetI-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257068024|ref|YP_003154279.1|
Sequence length 673
Comment ABC-type dipeptide/oligopeptide/nickel transporter ATPase [Brachybacterium faecium DSM 4810]
Sequence
MRPTLGSRLRSVSGSPLAPFTALPWASRIAVLFLALLAVVAVFAPLFSPHGPLATGTPVQ
PPSAEHWMGTDAIGRDIFSRVTHGARSSLLIGLAATAGALLAAAVIGSIAATGAKFLSEV
VMRVLDVVMSFPGIALAAVFVAVFGTSLPVLVFAIGFLYVPQLARVVRANVLSQFGEDYV
AASQVMGASTPWILAKHVARNCIAPIMVFATVLVADAIVLEASLSFINAGVQPPNPSWGN
ILADGKQLLLSGYWWPTFFPGLMILLTTLALNILSEGLTDAMASPPVKVDVDVEADEQAA
SAVEPASPEHTEEEHEVLGATDDETAHRLLIESLTALRAAELSRPERAPADDTSAPLLEV
QDLRVSFPEAHGEVDILDGISFQVRPGETMGLVGESGSGKSVASLAVMGLLPRTARISGR
VLLNGTDLLTLPAKRINALRGHEIAMIYQDALSSLNPSMLIRSQMAQLTRRGGTRSASEL
LELVGLEPQRILNSYPHELSGGQRQRVLIAMALTRDPKLVIADEPTTALDVTVQKQVVDL
LNSLREELGFAMVFVSHDLALVSQLADRITVMYAGQVMEQATTHELLIDPRHEYTRGLLG
SVLSIEAGAERLHQVPGTVPSPRDFASGDRFAPRSLDPSADPAARPELLEVGVPGHRVST
TGAVPPALEGAQR
Download sequence
Identical sequences C7M9Z5
446465.Bfae_08350 gi|257068024|ref|YP_003154279.1| YP_003154279.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]