SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068025|ref|YP_003154280.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068025|ref|YP_003154280.1|
Domain Number 1 Region: 92-303
Classification Level Classification E-value
Superfamily MetI-like 0.00000000000000621
Family MetI-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257068025|ref|YP_003154280.1|
Sequence length 321
Comment ABC-type dipeptide/oligopeptide/nickel transporter permease [Brachybacterium faecium DSM 4810]
Sequence
MSQLVRLIGRRLLALPLMILGVTLLVFVIMSFSPADPARLALGESASQEALENYREANGL
NDPIWLRYFTFLAGMVRGDLGTSSGNVPVTEMVAHAFPITLQLTFLGLAIAIVLSAILGV
LAALFRDRWVDQVIRVLTIAALATPSFWLAILMIQWLGEIPGGWGMFPALITRWVGFFDD
PATYLRNVALPALALGVPVAGSLTRVVRTAMVEELDRDYVRTAVGAGIPYPVVVSRNVLR
NALITPITVLGLRVGYLMGGAVIIEIIFNIQAMGQLILDGVTRNDVFLVQGVTLVVAIAF
IVVNIAVDLLYVVVNPRIRSI
Download sequence
Identical sequences A0A1X6XJB0 C7M9Z6
446465.Bfae_08360 gi|257068025|ref|YP_003154280.1| YP_003154280.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]