SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257068088|ref|YP_003154343.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068088|ref|YP_003154343.1|
Domain Number 1 Region: 18-66
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000224
Family DNA-binding N-terminal domain of transcription activators 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257068088|ref|YP_003154343.1|
Sequence length 72
Comment DNA-binding protein, excisionase family [Brachybacterium faecium DSM 4810]
Sequence
MNASTERPSAGDEDATELLTPAEVAKMFHVDPKTVTRWAQAGKLTYMRTLGGHRRYRRDE
VIDLLRDSSKDV
Download sequence
Identical sequences C7MAJ5
YP_003154343.1.138 gi|257068088|ref|YP_003154343.1| 446465.Bfae_08990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]