SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068105|ref|YP_003154360.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068105|ref|YP_003154360.1|
Domain Number 1 Region: 4-382
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.41e-34
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0037
Further Details:      
 
Domain Number 2 Region: 360-472
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 4.81e-31
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257068105|ref|YP_003154360.1|
Sequence length 475
Comment pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase component [Brachybacterium faecium DSM 4810]
Sequence
MNAPTHYDIALIGSGSANSFPGPEFADRRIVQIDRGVGPDRVFGGTCLNLGCIPTKMFVH
TADLAHATTDAARFGLTEQLQDVDWPAIRDRIFGRIDPITAGGEEYRRDHEDNANLTLLR
GTARFIGDRTLHVIGEDGGEQTVTADTVVLGAGSRPALPPVDGLAEAAPHTSDTIMRIER
LPASLAILGSGVIAVEMAHIFASLGVEVTLVARSQQVLRDADADISARLTELLGQRLRLE
KGLSTTSVRRTGAGVELRGVQDGAEVLIEAEELLVATGRRPNSDLLDVAAAGIDTAEDGR
VRVDAHQRVLGGGRVLEGLWAFGDLSSAHQLKHVANHEQRIVRHNILHPGQLRRSDTMPV
PSGVFTHPQVAWVGMDEETARAGGRGVKVAVQEYASIAYGWALEDSTGFAKIIADAETTE
ILGAHLIGPEATTLVQLLIQAMSTGQTARDIAATQYWIHPAMPELIENALLQLVP
Download sequence
Identical sequences A0A1X6X3J6 C7MAL2
YP_003154360.1.138 gi|257068105|ref|YP_003154360.1| 446465.Bfae_09170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]