SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068135|ref|YP_003154390.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068135|ref|YP_003154390.1|
Domain Number 1 Region: 87-169
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase, C-terminal domain 1.7e-32
Family Methylated DNA-protein cysteine methyltransferase, C-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 15-93
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase domain 0.0000000000000141
Family Methylated DNA-protein cysteine methyltransferase domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257068135|ref|YP_003154390.1|
Sequence length 172
Comment O-6-methylguanine DNA methyltransferase [Brachybacterium faecium DSM 4810]
Sequence
MTPSRPADTARPRHRRIATPLGLYLIAAEGAAVTGLWRQDQSRFPGPERLGPAAPSPDPL
LDVAEQQLLAYLAGEREEFDLPLDLRGTAFQQEVWTLLRTIPRGSTTTYGQIARALGRPR
AAQAVGAAVGANPLSIVVPCHRVVGSSGAITGYAGGIETKQALLLLEGALLA
Download sequence
Identical sequences A0A1X6WYF1 C7MAP2
446465.Bfae_09470 YP_003154390.1.138 gi|257068135|ref|YP_003154390.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]