SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068153|ref|YP_003154408.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068153|ref|YP_003154408.1|
Domain Number 1 Region: 13-229,394-646
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.75e-101
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00015
Further Details:      
 
Domain Number 2 Region: 655-874
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 3.36e-34
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.001
Further Details:      
 
Domain Number 3 Region: 231-385
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 4.32e-31
Family ValRS/IleRS/LeuRS editing domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257068153|ref|YP_003154408.1|
Sequence length 895
Comment valyl-tRNA synthetase [Brachybacterium faecium DSM 4810]
Sequence
MTDTASRPDTGSALPDRPSLEGLEEKWDGVWSAQELYAFDPETTRDQVFSVDTPPPTASG
SLHIGHVFGYSQADMIVRYQRMRGMNCFYPLGWDDNGLPTERRAQNYYGVRCDPSLPYDP
DFTPPQEGGSNKSSKAANQLPISRRNFIELCEQLTTLDEKSFEEVFRTLGLSVDWNHSYQ
TIDARSRATSQRAFLENLAKGQAYQAEAPTMWDVTYRTAVAQAEQEDRERDGAYHRIGFT
RTNAADGADATVYIETTRPELLPACVALVAHPEDERYQELFGTTVTSPLFGVEVPVMAHP
LAQPDKGAGIAMICTFGDSNDVTWWRELELPTRSVVGRDGRFLPEAPWITTAEGQAAYAE
LVGLTVFSAQKRVVEMVTESGDLVGEPEKITHPVKFYENGDKPLEFVTSRQWYLTNGGRD
QSEGGLRDALIARGAEMTWHPAYMESRYRNWVEGLAGDWLISRQRFYGVPFPVWYGVGAD
GETDYSTVLTPAVEDLPVDPTIDVPAGFTEEQRDQPGGFVADPDILDTWATSSLTPQLAG
GWNAQDDGELFSKVYPMDLRPQGHDIIRTWLFSTIVRSHLQQDSLPWKHASINGWILDPD
RKKMSKSKGNVVTPLGLLQQHGSDGVRYWAGRARQGVDTAFDEGQMKIGRRLAIKILNAS
KFALGFGEAPADPSGRLAADPAVVTDPLDRALLAQLADVVEQSTAAFDEMDYARSLEVAE
PFFWAFCDDYIELVKERAHGNSPDGEVGAASARAALAIALEVLLRLFAPVIVFATEEVWS
WWREGSVHTQPWPEAAPLREAAAGQDAALVDSVAQAAITLRRIKSDAKVSQKTPILSVTI
EAPQEALAYLEAASADLTALGRIEKFELVTGQGEEILTRDVELGEPPVKQPRAKG
Download sequence
Identical sequences C7MAR0
gi|257068153|ref|YP_003154408.1| 446465.Bfae_09690 YP_003154408.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]