SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068210|ref|YP_003154465.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068210|ref|YP_003154465.1|
Domain Number 1 Region: 11-237,430-501
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.39e-87
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00085
Further Details:      
 
Domain Number 2 Region: 486-592
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.78e-25
Family Anticodon-binding domain of Class II aaRS 0.002
Further Details:      
 
Domain Number 3 Region: 243-403
Classification Level Classification E-value
Superfamily YbaK/ProRS associated domain 0.000000235
Family YbaK/ProRS associated domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257068210|ref|YP_003154465.1|
Sequence length 594
Comment prolyl-tRNA synthetase [Brachybacterium faecium DSM 4810]
Sequence
MIRLSSSFIRTLREDPADAEVASHKLLVRAGYIRRSAAGVYTWLPLGLKVLRKVEQIVRE
EQDAIGGQEVLFSALQPREPYEATGRWEDYGPNLFRLQDRKQDDYLLAPTHEEMFTLTVK
DLFSSYKDLPTMLYQIQAKYRDEARPRAGLLRTREFLMKDAYSFDVDDEGLDASYEKQRL
AYQRTFERLGLPTVICRADAGAMGGSRSEEFLHPTPVGEDTFVVSDGGYAANVEAVTTPA
PPALDEAAIAALPAMHVEDTPGASTIAKLTDFSNQAFPGKGPTTDSGEWTRYEMLKHLVY
LLTHPDGSTEPLVIALPGDREVDAKRLEAAVAPAIASPFTDEDFSAHPVLKKGYIGPEGL
GLEAEAGICYLVDPRVVPGSSWVAGAGEKDKHVYDLVYGRDFTADGTIEAAEVRDGDPAP
DGSGPMRLTRGMEMGHIFQLGRTYAEALGLKVLDENGKSVVVTMGSYGIGVTRAIAAVAE
LCHDEKGLCWPRQLAPADVHIVATGKDPAIFAEAERIAGALEARGLEVLYDDRPKVSPGV
KFKDSELLGVPTSVVVGRGLATGVVEVRDRAGGEIREVSPEEVVDAVTAEVRGA
Download sequence
Identical sequences C7MBA2
YP_003154465.1.138 446465.Bfae_10270 gi|257068210|ref|YP_003154465.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]