SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068221|ref|YP_003154476.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068221|ref|YP_003154476.1|
Domain Number 1 Region: 10-154
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.24e-41
Family Ribonuclease PH domain 1-like 0.000000846
Further Details:      
 
Domain Number 2 Region: 332-503
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.3e-41
Family Ribonuclease PH domain 1-like 0.00000131
Further Details:      
 
Domain Number 3 Region: 485-584
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.78e-23
Family Ribonuclease PH domain 2-like 0.0000217
Further Details:      
 
Domain Number 4 Region: 155-268
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.64e-21
Family Ribonuclease PH domain 2-like 0.0000116
Further Details:      
 
Domain Number 5 Region: 593-679
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.47e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Domain Number 6 Region: 273-356
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000288
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00045
Further Details:      
 
Domain Number 7 Region: 657-736
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000114
Family Cold shock DNA-binding domain-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257068221|ref|YP_003154476.1|
Sequence length 753
Comment polynucleotide phosphorylase/polyadenylase [Brachybacterium faecium DSM 4810]
Sequence
MAMEGPEITATTAVIDNGSYGRREIRFETGRLAQQAAGAVAVYLDDDTMVFSATAVSNKP
KEHFDFFPLTIDVEERMYAAGRIPGSFFRREGRPGTDAILAARLTDRPLRPAFVKGLRNE
VQVVLTVMANGPDDAYDVVGINGASASTQISGLPFSGPIGAVRIALMPNSQGGGQWVAFP
TFSQLDEAVFSMVVAGRIVEDDVAIMMVEAEATDNSWNLIKEQGAIAPTESVVAEGIEAA
KVFIRSLCVAQQELAATAAKPVREFPLFLDYQDDAYEIVEAAATERLAEVMSIAAKTERE
ERTEQLLAEITEELSGEGKQLEDREKEVTGAFRALTKQVVRKKVLTEGVRIDGRGLRDIR
ALSAEVEVLPRVHGSALFQRGETQIMGVSTLNMLKMEQQIDSLGPVERKRYIHHYNFPPY
STGETGRVGSPKRREVGHGMLAERAIVPVLPSREEFPYAIRQVSEALGSNGSTSMGSVCA
STLSLLNAGVPLRAPVAGIAMGLISDTIEGEIRYAALTDILGAEDAFGDMDFKVAGTGEF
ITAIQLDTKLDGLPASVLTGALSQAHEARLAILGVLGEAIDAPDEMSPNAPRVLAVTVPV
DKIGAVIGPKGQMINQIQDDTGADITIEDDGTVYIGATDGPSAEAARSAVNAIANPMVPE
VGERYLGTVVRVVDFGAFISLTPGKDGLLHVTQLRKLNGGKRVDNVEDVATVGQKIEVEI
REIDARGKISLAVIEEDEAESAESAASEATTAE
Download sequence
Identical sequences C7MBB3
446465.Bfae_10380 gi|257068221|ref|YP_003154476.1| YP_003154476.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]