SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257068346|ref|YP_003154601.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068346|ref|YP_003154601.1|
Domain Number 1 Region: 4-166
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000593
Family Thioltransferase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257068346|ref|YP_003154601.1|
Sequence length 206
Comment hypothetical protein Bfae_11650 [Brachybacterium faecium DSM 4810]
Sequence
MTARTVELFVDPVCPFAWMTSRWLLHAAEVREVTPKFSVMSLSVLNEGRDLDPGYRASMD
DAWGPARLAIAIGRAEGEEAVARWYTAWGERFHVGGESSDRRATAVAALADAGLPESLIE
AYAPVAGDEVDQALRASHARALSRVGDEVGTPVISFGEGTAYFGPVVSPAPKGEEAGKLL
DALATMATIDGFYELKRSRTGGVDLS
Download sequence
Identical sequences C7MBQ4
gi|257068346|ref|YP_003154601.1| YP_003154601.1.138 446465.Bfae_11650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]