SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068403|ref|YP_003154658.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068403|ref|YP_003154658.1|
Domain Number 1 Region: 123-318
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 7.95e-20
Family BC ATP-binding domain-like 0.0082
Further Details:      
 
Weak hits

Sequence:  gi|257068403|ref|YP_003154658.1|
Domain Number - Region: 9-76
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0972
Family FAD-linked reductases, N-terminal domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257068403|ref|YP_003154658.1|
Sequence length 419
Comment putative ATP-grasp enzyme [Brachybacterium faecium DSM 4810]
Sequence
MRPPSSPADPGFDVVVLGAGLNSLNLTIAFHQQYGMRCTTVVRVPVAMNQHTVTSDQLVL
GADATDEQMRDALLELAARRPAGRPALLLTNADSLIEFIDRFREELEQHYLLAQVDGALL
SRLADKAEFAQICEQLGIGTVPTVIVDFSRAEETDWNGEQELPWSYPVVGKAANTAEYHH
VDFPGKRKVFFLESREEHLDLVRRLRGSGFTGRFLFQELIPGDDTAERSITAYRSSRGKV
TLLCAAQVLLGEHTPEALGRPAAMVTGDFPSLTAAAERFLDAVDYVGFANFDVKVDPRTG
AECFFEINPRIGRNNYYVTAAGESVARHVVADRVLDQDIAQVVVAREVLYSILPVSLVLR
YLRDPALRTRIRRLARTGLRNPFRYRPEGLWMRAYSVVSGLNFVRKYRAVYPRPTDTGF
Download sequence
Identical sequences C7MBW1
gi|257068403|ref|YP_003154658.1| 446465.Bfae_12250 YP_003154658.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]