SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068449|ref|YP_003154704.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257068449|ref|YP_003154704.1|
Domain Number - Region: 20-80
Classification Level Classification E-value
Superfamily PIN domain-like 0.0844
Family PIN domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257068449|ref|YP_003154704.1|
Sequence length 249
Comment hypothetical protein Bfae_12710 [Brachybacterium faecium DSM 4810]
Sequence
MRRAGPPPRTGRRGPARLDNLSLRDQLRVDRLPLRLLQMMVGLSGFGFSLAMLLRSGLGG
APWDVLHAAIAERLGLTVGTVSISVSFVVLLLWFPLRERIGIGTIANSIWVGVSLDLGML
VLPEARGLPLAVAMMLLGVLLNGVSGAVYIGAQLSAGPRDGLMTGLGRVLRRPVGPVRIV
LEVIVLLTGWSLGGPLGAATVVYAIGLGPVIQLTLPLVTIPVRTVGGKALPAPGDDQPRP
WRSRTPEIS
Download sequence
Identical sequences C7MC07
YP_003154704.1.138 gi|257068449|ref|YP_003154704.1| 446465.Bfae_12710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]