SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257068459|ref|YP_003154714.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068459|ref|YP_003154714.1|
Domain Number 1 Region: 4-186
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 5.71e-76
Family GTP cyclohydrolase I 0.00000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257068459|ref|YP_003154714.1|
Sequence length 188
Comment GTP cyclohydrolase I [Brachybacterium faecium DSM 4810]
Sequence
MAVDKPRIEAAVREILAAIGEDPDRDGLLDTPSRVARMYDEVFEGLAQDAREPLSTTFDI
EHQELVLVRDIAFYSMCEHHLLPFHGTAHIGYIPGGGVVTGLSKLARLVNIYARRPQVQE
RLTFQIADALMEELGAGGAIVVIEAEHMCMSMRGVRAAGARTVTSAVRGMLRDSPSTRGE
AMALIHRA
Download sequence
Identical sequences A0A1X6XA87 C7MC17
gi|257068459|ref|YP_003154714.1| 446465.Bfae_12810 YP_003154714.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]