SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068474|ref|YP_003154729.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068474|ref|YP_003154729.1|
Domain Number 1 Region: 8-274
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.09e-25
Family FAD-linked reductases, N-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257068474|ref|YP_003154729.1|
Sequence length 494
Comment malate:quinone oxidoreductase [Brachybacterium faecium DSM 4810]
Sequence
MSDLDVTRADAVLIGGGIASATLAAMLTELEPSWDIVVLERLESLGAESSDAWNNAGTGH
SALCELNYTPQDVDGSVSPAKAISINEQFQVSRQFWAHLVENDRIGDPSRFIHTVPHMSF
VHGMENVDYLRRRHEALTANPLFDRMEFTTEHAQLAQWAPLVSEGRPVTETIAATRSPDG
TDVDFGALTREMLGFASRTGTTVSTGSEVVDLRRMGTDWGVMVRSTTDDALRVVRAPFVF
VGAGGYALPLLQKSGIDEIRGFGGFPISGQWLRCTDPEVIARHDAKVYGKAAVGAPPMSV
PHLDTRFVAGERSLMFGPYAGWSPKFLKTGRWTDLLESVKPSNVTQMMAVAPPNLDLMVY
LGSQLAATHHQRFEALLEYMPSARPEQWEEVTAGQRVQVIAPDRKKHGVLQFGTQLITAA
DGSIGGMLGASPGASTATSIMLGLLEKMFPQRIEQWRPALTQMVPSWGRSLSDDAEEAHR
TLDRTADALGLSHS
Download sequence
Identical sequences A0A1X6XPN1 C7MC32
446465.Bfae_12960 YP_003154729.1.138 gi|257068474|ref|YP_003154729.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]