SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068524|ref|YP_003154779.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068524|ref|YP_003154779.1|
Domain Number 1 Region: 9-189
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.019
Further Details:      
 
Domain Number 2 Region: 220-368
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000265
Family FAD/NAD-linked reductases, N-terminal and central domains 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257068524|ref|YP_003154779.1|
Sequence length 457
Comment NADH dehydrogenase, FAD-containing subunit [Brachybacterium faecium DSM 4810]
Sequence
MTNTFGGKPHVLILGGGSVGLTTASELRKTLGAEVAITVVDPRPYMTYAPFLPEVGAGSI
DPRNVLAPLRKILPGAKVVTGSVSAIRSAENTVVVELEDEEKLEITYDYLVVGLGAVPRL
LPIPGLAENAIGFKQVEEATAVRDRILANLGEAATTKDPALRKRLLTFTFIGGGFAGGEA
VSEAEDMVRDALRYYPDLHSSDIRFVLVDGAPFIFPELTEDQRAYVLNQLRERGIEVKLE
TFLNSAENGVIKTSDGDEFESDLLVWNAGVKPAPVLSDSEVSDLPVVTERGPLMGKLEAL
PDLRVNGADGPLDDVFTGGDCAAVPDLASGEGKFCPPNAQHAVRQAKRLADNIARSIQGR
PLVDYYHRNLGVMATLGMYKGVCRLQLGEKEVDVRGLPAWAMARAYHVYAMPTFGRKASV
VAGWATNLISRRDIIGIPQTETPRAAFEYAANTGKKK
Download sequence
Identical sequences A0A1X6XUP1 C7MC82
446465.Bfae_13490 YP_003154779.1.138 gi|257068524|ref|YP_003154779.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]