SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068556|ref|YP_003154811.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068556|ref|YP_003154811.1|
Domain Number 1 Region: 256-554
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.96e-89
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000201
Further Details:      
 
Domain Number 2 Region: 60-253
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.26e-48
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000298
Further Details:      
 
Domain Number 3 Region: 557-662
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 7.1e-27
Family Anticodon-binding domain of Class II aaRS 0.00035
Further Details:      
 
Weak hits

Sequence:  gi|257068556|ref|YP_003154811.1|
Domain Number - Region: 7-54
Classification Level Classification E-value
Superfamily TGS-like 0.0752
Family TGS domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257068556|ref|YP_003154811.1|
Sequence length 666
Comment threonyl-tRNA synthetase [Brachybacterium faecium DSM 4810]
Sequence
MAQIAITLDGSSQQLAEGTTGTEVFAGTATIVALRIDGELRDLDTVLAEGQSVEGVDISS
PDGLSILRHSAAHVLAQAVQKTNPEAKLGIGPPITDGFYYDFDVAEPFTPESLKALEKEM
HRIIKSGQRFVRREISDDAARAEEASEPYKLELIGLKSTAEDAAEGASVEVGEGGLTMYD
NVDKKGQTVWTDLCRGPHLPTTKLIGNGFALTRSAAAYWRGSEKNPMLQRIYGTAWPTKE
ELRAHQERIAEAERRDHRRLGSELDLFSFPDEIGSGLPVFHPKGAMVKMEMEDYSRRRHV
EAGYSFVSSPHITKKNLFETSRHLEWYAEGMYPPMHVDEERDDEGNITRQGQDYYLKPMN
CPMHNLVYRSRGRSYRELPLRLFEFGTVYRYEKSGVVHGLTRARGFTQDDAHIYTTREQM
KEELTSLLGFVLDLLRDYGLDDFYLELSTRDPEKSVGDETTWDEATRTLEEVATESGLEL
VPDPGGAAFYGPKISVQAKDAIGRTWQLSTIQLDFFEPELFELEYTAPDGSRQRPVMIHR
ALFGSIERFFGVLLEHYAGAFPVWLAPVQVVGVPVAAEYVPYLEEVAAKLRAHGVRVEVD
SSDDRMQKKIRTHTKEKVPYLLIAGGEDQAHGAVSFRMRDGSQDNGIDVDAAVDRIVTAI
RDKAQV
Download sequence
Identical sequences A0A1X6XWX1 C7MCB4
gi|257068556|ref|YP_003154811.1| 446465.Bfae_13900 YP_003154811.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]