SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068570|ref|YP_003154825.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068570|ref|YP_003154825.1|
Domain Number 1 Region: 6-343
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.21e-62
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000352
Further Details:      
 
Domain Number 2 Region: 354-433
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.000000000166
Family Anticodon-binding domain of Class II aaRS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257068570|ref|YP_003154825.1|
Sequence length 460
Comment histidyl-tRNA synthetase [Brachybacterium faecium DSM 4810]
Sequence
MAKIAALSGFPEWLPAERLVEQHVIDVFREVAELHGFSGIETRAVEPLEQLLRKGEIDKE
VYVLRRLHAEEEDGAEAGREDRSRTLGLHFDLTVPLARYVLEHQNDLVFPLRRFQIQKVW
RGERPQDGRFREFYQADLDVIGQDTLPGHIEAEVATVMAEILDRLPLPAFTIHANTRRLS
EGFFRSIGLEDQAAVLRSLDKLPKIGPDAVRELLLAEVGASVEQAQACLDFASIRTRDAS
FADRVRELGGSGEMVEQGIAELTSVLERVEAAVPGVIMADLSIARGLDYYTGTVFETFVT
GHEALGSVCSGGRYDALASDNRHTYPGVGLSIGLSRLVSRLLSAGLATASRSVPTCVLVS
VADEQHRHLSEAAARSLRSRGISCEVAPTAAKFGKQIRYADRRGIPFIWFPSADGGADQV
KDIRSGHQVEADAAAWQPPAEDLTARILGAGEAQDAPPTR
Download sequence
Identical sequences A0A1X6XWU5 C7MCC8
gi|257068570|ref|YP_003154825.1| 446465.Bfae_14040 YP_003154825.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]