SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068643|ref|YP_003154898.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068643|ref|YP_003154898.1|
Domain Number 1 Region: 128-400
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 7.42e-102
Family BC ATP-binding domain-like 0.0000000285
Further Details:      
 
Domain Number 2 Region: 687-964
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.36e-85
Family BC ATP-binding domain-like 0.00000133
Further Details:      
 
Domain Number 3 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.88e-46
Family BC N-terminal domain-like 0.000002
Further Details:      
 
Domain Number 4 Region: 563-688
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.87e-40
Family BC N-terminal domain-like 0.00000327
Further Details:      
 
Domain Number 5 Region: 396-558
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 1.29e-32
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00025
Further Details:      
 
Domain Number 6 Region: 970-1105
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 9.29e-29
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257068643|ref|YP_003154898.1|
Sequence length 1117
Comment carbamoyl-phosphate synthase large subunit [Brachybacterium faecium DSM 4810]
Sequence
MPRRPDISSVLVIGSGPIVIGQAAEFDYSGTQACRVLREEGLRVILVNSNPATIMTDPEI
ADATYVEPIEPEIIRSIIEKERPDALLPTLGGQTALNAAIALAENGTLEELGVEMIGASL
EAINKAEDRQLFKEVVERVGGESARSRICHSMDELLEAADELGYPMVVRPSFTMGGLGSG
MAYDEADLRRIGGDGLHYSPTNEVLLEESILGWKEFELELMRDSADNCVVVCSIENVDPV
GVHTGDSVTVAPALTLTDVEMQTLRDLGIAIIREVGVDTGGCNVQFATHPETGRVVVIEM
NPRVSRSSALASKATGFPIAKIAARVAIGYTLDEIRNDITGTTPASFEPALDYVVVKVPR
FAFEKFPAADATLTTTMKSVGEAMSLGRNFTEALGKAQRSIDVKGASLSYRGAPPTAAEV
TELLDASRTPTAGRLVDIGRILWSAAEGVVDPAETLDRLVEATAIDRWFLDQMLLVAEIA
AEIRAAEVLDAELLALAKRHGLSDDQIGVLAGRSGEVVKGVREALGINPVYKTVDTCAAE
FASRTPYHYSTYDQETEVEPRERPAVLILGSGPNRIGQGIEFDYSCVHAAMALGNRDLPG
GGYETVMINCNPETVSTDYDIADRLYFEPLTFEDVVEVYEAEKAAGPVAGVIVQLGGQTP
LALARQLEAAGLPIIGTSPAAIDNAEDRGHFGALLAEADLPAPPYGTAWGLSDAVEVAAN
VGYPVLVRPSYVLGGRGMEIVFDEPGLIDYVGRNLPDGGRAEAPILIDSFLDTAIEIDVD
ALYDGTELYLGGVMEHIEEAGIHSGDSACTLPPITLSDAVLERIRTSTLAIAEGVGVRGL
LNIQYALSHGVLYVLEANPRASRTVPFVAKATGVPLAQAAALLMAGTSIADLRRGGVLPA
EGDGSDLPDDSPIAVKEAVLPFKRFRTHEGKAVDSVLGPEMRSTGEVMGLDSTFPLAFAK
SQLAISAHGLPTSGTAFVSVADRDKRSLALPVARLAALGFEILTTAGTGRVLRRYGIPCR
VLRKASEPGDDASVIELIEDGQVDLVLNTPSGSNARVDGYAIRAAATSMDVPMITTLQEF
QAGVQAIEARPVEPFEVTSLQDHTARLATARAARLGA
Download sequence
Identical sequences A0A1X6XW13 C7MCK1
gi|257068643|ref|YP_003154898.1| YP_003154898.1.138 446465.Bfae_14770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]