SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068648|ref|YP_003154903.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068648|ref|YP_003154903.1|
Domain Number 1 Region: 195-419
Classification Level Classification E-value
Superfamily CoaB-like 2.22e-55
Family CoaB-like 0.0000286
Further Details:      
 
Domain Number 2 Region: 7-180
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 3.14e-51
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257068648|ref|YP_003154903.1|
Sequence length 423
Comment phosphopantothenate-cysteine ligase /phosphopantothenoylcysteine decarboxylase [Brachybacterium faecium DSM 4810]
Sequence
MSSVLRTLAGARVLVGVGGGIAAYKTAHLVRGLVGEGADVRVVPTASSLEFVGAATWEAL
SHHEVLTSVFEDVDEVAHVRFGQEADLLVIAPATADLLARLRIGRADDMLTASALVTRAP
LVVAPAMHTEMWEHPSTRENVAVLRERGVTVLEPAVGRLTGPDSGPGRLPEPEALLAAAR
AAIAAPRDAAGAVRRDLLGRELLITAGGTREDLDPVRFLANHSSGKQGWALAHAALVRGA
RVRLAAANVDLETPPGAQRLDVGSAAELAELVAEHRGQVDALVMAAAVADFTAADRADSK
IKKDDGDEDSVPAIALRRTQDILRHSVLDRAERGGARPAIVGFAAETGGEGGSALDLARA
KARRKGADLLVFNDITGGVFGAADNSVRVLDREGEEVSHTSGSKTAVAHAVLDELLPHLP
EVP
Download sequence
Identical sequences C7MCK6
446465.Bfae_14820 YP_003154903.1.138 gi|257068648|ref|YP_003154903.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]