SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068663|ref|YP_003154918.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068663|ref|YP_003154918.1|
Domain Number 1 Region: 495-902
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.11e-129
Family DNA polymerase I 0.0000000252
Further Details:      
 
Domain Number 2 Region: 8-178
Classification Level Classification E-value
Superfamily PIN domain-like 1.02e-48
Family 5' to 3' exonuclease catalytic domain 0.0000282
Further Details:      
 
Domain Number 3 Region: 179-291
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 2.09e-25
Family 5' to 3' exonuclease, C-terminal subdomain 0.0007
Further Details:      
 
Domain Number 4 Region: 330-440
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000834
Family DnaQ-like 3'-5' exonuclease 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257068663|ref|YP_003154918.1|
Sequence length 904
Comment DNA polymerase I [Brachybacterium faecium DSM 4810]
Sequence
MSASDTDDQRILLIDGHAMAFRAFFALPADGFSDGRGQATNAVYGFTRMLINVVASERPT
HVAVAFDLPGGTFRDRIYDQYKGGRDETPPAFHGQIDLIMQVLDALGVRWLTYEDYEADD
IIATLATRAEAAGDEALIVSSDRDAIQLVGAKVTLLQPIKGVTEMRRMTPAAVEEKYGIP
PERYPDLAALVGEAADNLPGVPGVGPKTAAKWLTQYGDLPGLIAHAGEIKGKAGQSLRDH
LEDVERNRLMNAAYTTLDLPEDPAHYSLGGGDRARVLEVFDDLAFGDTIRRDLPATLLGE
DPQESGGPAPEEAEVLAVDGPDALRELLGEEGGLLALDVVEDVRGGPLMGLATPSARGAI
ALSSLDSETSTALGAALEEAAEIRVADAPAVRSWLAENGYRLGAQVRDLSLESFVLRPGA
RSYDAEALASDLGGASFEPKPRKPAASTLQKESAEVRAEHIARAGGRLAATAAALHPAAE
ELTARTGEAPWARRILDELEQPLQRVLETMHERGIAIDEQALAALREEFEGFVAQAKREA
GAIVGEEVNLASPKQLQVVLFETLALPTTRKISSGHSTDAESLTDLQESLDPESSGHQFL
SWLLRFREMSKLTGYLVGLDKVVDAGSRVHTTFQQTAAATGRLASTEPNLQNIPVRTAEG
QRIRDAFVAGEGFETLLTADYSQIEMRIMAHLSEDAGLIEAFNSGEDLHNFVASRVFGVS
PDAVDPAMRSKTKAVSYGLAYGLSAFGLSRQLRISRAEATALRDGYFERFGGVRDYLHHT
VETARTTGYTETILGRRRYLPDLTSDNRQRRENAERVALNSPIQGSAADIIKLAMLRVES
RMRAAELSSRMLLQVHDELVVEVAAGELDQVREIVEEGMGSAYQLSVPLDVGVGIGRTWR
EAAH
Download sequence
Identical sequences C7MCM1
446465.Bfae_14980 gi|257068663|ref|YP_003154918.1| YP_003154918.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]