SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068703|ref|YP_003154958.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068703|ref|YP_003154958.1|
Domain Number 1 Region: 77-302
Classification Level Classification E-value
Superfamily MetI-like 3.53e-55
Family MetI-like 0.00012
Further Details:      
 
Weak hits

Sequence:  gi|257068703|ref|YP_003154958.1|
Domain Number - Region: 36-61
Classification Level Classification E-value
Superfamily MalF N-terminal region-like 0.000968
Family MalF N-terminal region-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257068703|ref|YP_003154958.1|
Sequence length 314
Comment carbohydrate ABC transporter membrane protein [Brachybacterium faecium DSM 4810]
Sequence
MTTDAPTTARPAAPPPGASRPSRLGDRLTPIRALPMLPAGLLLVGFMLGPILYSLYLAFT
DSAIRGAGASDTSFVGLSNFTDAFTDADFWNSVILTLIFTIVSAVIGQNVMGMLLALLME
RAQRVLSFAVTSLVIAAWILPEVVAGYLLYTFFADEGSLNTILSSIGLPTQNLLFSAPIL
AVSFANIWRGTAFSMLVYSAALSSVPADVYESAALDGAGPVRRFRSITLPLLRPAIATNL
MLTTLQTLSVFGLIFIMTGGGPARQSQTLPLYMYEQAFSYGQLGYGTAVALLLLLIGAAA
SLVYLRLLPEEEKR
Download sequence
Identical sequences A0A1X6XVL6 C7MCR1
gi|257068703|ref|YP_003154958.1| 446465.Bfae_15390 YP_003154958.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]