SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068804|ref|YP_003155059.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068804|ref|YP_003155059.1|
Domain Number 1 Region: 3-335
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0001
Further Details:      
 
Domain Number 2 Region: 348-464
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.41e-27
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257068804|ref|YP_003155059.1|
Sequence length 467
Comment dihydrolipoamide dehydrogenase [Brachybacterium faecium DSM 4810]
Sequence
MAETTTDQFDVVILGGGSGGYAAALRGAQLGQKIALVEKDKLGGTCLHRGCVPTKALLHV
GELADAPSEAAAAGVDLSLNGIDAAKVLGFKDKIIGRLHKGLQGLVKSRKVEYVEGFGTL
TGANTVSVETESGTRTLTGKNIILASGSFSKTLPGIDLGGRFLDSEAALQLPEIPKNPII
LGGGVIGVEFASVWKSLGAESVTIIEGLPHLVANEDEALSKALERAYKKRGIAFSLGVFT
EKAEQTEDGVKVTLADGKVFEGDYLLVAVGRGPNTTGLGYEEQGIEMDRGFVLAEAETLE
TSVPGIYAVGDIVPGLQLAHRGFAQGIFVAERIAGLNPAPIVESGIERITYCEPELGSVG
LSEKQAKEQLGADAVEVYEYNLGGNGKSQILGTTGFIKLVREKDGPIIGVHMIGTRTSEL
MGEALLIVNWEAYPEDVASLIHGHPSQHEALGEAALALAGKPLHAHA
Download sequence
Identical sequences A0A1X6X8X7 C7MD12
YP_003155059.1.138 446465.Bfae_16430 gi|257068804|ref|YP_003155059.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]