SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068869|ref|YP_003155124.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068869|ref|YP_003155124.1|
Domain Number 1 Region: 28-252
Classification Level Classification E-value
Superfamily Undecaprenyl diphosphate synthase 3.01e-83
Family Undecaprenyl diphosphate synthase 0.00000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257068869|ref|YP_003155124.1|
Sequence length 269
Comment Undecaprenyl pyrophosphate synthetase [Brachybacterium faecium DSM 4810]
Sequence
MPGADRHGYQEPFAHPSGARPPQLPAPTIPGHVAVVMDGNGRWANRRGLPRTAGHEAGEA
ALLDVVAGALQIGVTHLSAYAFSTENWKRSPEEVRFLMGFSRSVLRRQRDTLNSWGVRIV
WIGRAQRLWGSVIKELREAEELTRHNTRMTLYMCVNHGGRAEIVDAVREIAEEARAGRLS
ARGITMKSFARHLNDPDMPDVDLFLRTSGEQRTSNFLLWQAAYAELVFVEELWPDVDRRV
LWRAITEYARRDRRYGGAIDAPEQDTAPA
Download sequence
Identical sequences A0A1X6Y174 C7MD77
446465.Bfae_17130 YP_003155124.1.138 gi|257068869|ref|YP_003155124.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]