SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068912|ref|YP_003155167.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068912|ref|YP_003155167.1|
Domain Number 1 Region: 7-138,173-399
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 8.73e-91
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000183
Further Details:      
 
Domain Number 2 Region: 404-531,560-592
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.33e-28
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00086
Further Details:      
 
Domain Number 3 Region: 139-173
Classification Level Classification E-value
Superfamily Methionyl-tRNA synthetase (MetRS), Zn-domain 0.0000000000131
Family Methionyl-tRNA synthetase (MetRS), Zn-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257068912|ref|YP_003155167.1|
Sequence length 599
Comment methionyl-tRNA synthetase [Brachybacterium faecium DSM 4810]
Sequence
MSTVLSAVAWPYANGPRHIGHVAGFGVPSDVFSRYMRMAGHDVLMVSGTDEHGTPILVEA
DKEGISARDLADRNNRLIVEDLVALGLSYDLFTRTTTRNHHQVVQDMFVTVRDNGYMIEQ
TTSGAISPSTGRTLPDRYIEGTCPICSAGGARGDQCDNCGNQLDPTDLIDPVSRINGETP
EFVETSHWFLDLPALAAELGRWLDEREATGLWRPNVIRFSQNILEDIKPRAMTRDIDWGI
PVPGWEDQPNKRLYVWFDAVIGYLSASIEWARRSGDPEAWRRWWNDPETLAYYFMGKDNI
VFHSQIWPAEMIAQNGQGDKGGEPGRFGELKLPTEVVSSEFLTMEGKKFSSSKGIVIYVR
DVLERYQPDALRYFISAAGPENQDADFTWVDFVSRTNNELVAGWGNLVNRTAAMIAKNVG
EIPEAGEFEEIDTALLDQIREGFTTVGGLIEAHRQRAAIAEAMRLVGEANAYVSRTEPFK
MKAEEQRPRLLTVLHVLAQAVTDLNTMLAPFLPQSANAVERALGGQRQIAPMPRIEEVED
LDGGPRYPIITGDYTDVPAWEHRPVTPGQTVAKPTPIFVKLDPTIAEQELERLEAAAEE
Download sequence
Identical sequences C7MDC0
446465.Bfae_17560 gi|257068912|ref|YP_003155167.1| YP_003155167.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]