SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068929|ref|YP_003155184.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068929|ref|YP_003155184.1|
Domain Number 1 Region: 83-271
Classification Level Classification E-value
Superfamily MetI-like 2.35e-20
Family MetI-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257068929|ref|YP_003155184.1|
Sequence length 331
Comment ABC-type dipeptide/oligopeptide/nickel transporter permease [Brachybacterium faecium DSM 4810]
Sequence
MSTPNAPVTDEKAAPRSNPFRSFNFSSRFWIALVLVAGIVLLGLAGLVYPTSSSEKVGSL
YDAPGDGLLLGTDNFGHDVVAVLMAGTRTSLIIGLVAGIVATTIGVLIGLLSGYVGGWFE
ELLMGITNVVLAIPSIIVLILISISLPQSSIWSLAIVIGITSWPWTARAVRAQASSVATR
EHIDVARLSGARLPAILLKDVLPYILSYTVMAFVLQVAGAILAEAALSMLGLGPSGADSL
GTQLHWALAFQAVASGAWWAFLPPTIVLTLVSFGFLLLQASLDEVFNPRLRRGKRKQMKQ
AAARRAEEARLLAEQPFPADAPEPTRAGEHA
Download sequence
Identical sequences A0A1X6Y0H6 C7MDD7
gi|257068929|ref|YP_003155184.1| 446465.Bfae_17740 YP_003155184.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]