SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068943|ref|YP_003155198.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068943|ref|YP_003155198.1|
Domain Number 1 Region: 28-314
Classification Level Classification E-value
Superfamily MetI-like 2.22e-51
Family MetI-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257068943|ref|YP_003155198.1|
Sequence length 315
Comment carbohydrate ABC transporter membrane protein [Brachybacterium faecium DSM 4810]
Sequence
MTTSTRTLPSNRTFRPRPQNVVNRVADPLFVIITYGIIALAILLIVYPLYFIVIASISDP
NLVQQGKVVLFPRGVTFDGYLTIFGTSTIVRGFMNSVMYTAVGTFISVAMILFGAYALAR
KDMPGRNVFMILFVVTMFFDGGMIARYLVVKELGMLDTMWAVVLPGAVGVWNLVIARTFF
EQNLSPELREAAQLDGASDFRFFFSIALPLSKPLIVLMAMIHIVANWNAFFDAMIYLSDE
SKYPLQLILRNVLIQSQASASGMDMASMDSTAAAQKMGELLKYSMIVVSTIPLLVAFPFL
QRYFIKGATLGALKS
Download sequence
Identical sequences A0A1X6Y0E7 C7MDF1
YP_003155198.1.138 gi|257068943|ref|YP_003155198.1| 446465.Bfae_17880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]