SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257068958|ref|YP_003155213.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068958|ref|YP_003155213.1|
Domain Number 1 Region: 118-181,223-347
Classification Level Classification E-value
Superfamily MetI-like 0.000000000000011
Family MetI-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257068958|ref|YP_003155213.1|
Sequence length 360
Comment ABC-type dipeptide/oligopeptide/nickel transporter permease [Brachybacterium faecium DSM 4810]
Sequence
MSTALDPEAEDTPRRTRRRASGGLGRYILVRFLLIIPTVLILMTMVFFLMRITGDPITAA
LGGRLTPDQLAQRRAEAGYDRPLIVQYFDYLGGVLRGDFGTTYTDNTPVTEVLTTYGAAT
FELVVYSLVVALLLGVPLGMIAARTRDRWPDAVLRIIAILGYATPVFFVGLLLKLVFSVG
LGWLPVAGRLSTSGQITMSTILNPSPFSLLDALRLGDTELLRDVLGHAVLPAVALGILTG
GVFLRLVRTNMIGTLEMQYIESARSRGVAETRLTTRHGLRPALIPIITVMGMQVAMMLGG
AVLTETTFEWNGLGYMLAEYMKARDYIAVQGIVMMLAVIVALSNFVVDVIAALIDPRVRY
Download sequence
Identical sequences C7MDG6
gi|257068958|ref|YP_003155213.1| 446465.Bfae_18030 YP_003155213.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]